Customize

qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm Mug

This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc. Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.

Tee Hoodie

The Urban Dictionary Mug

Ceramic mug (11 oz)
Printed on-demand just for you
Dishwasher safe
Microwave safe
Word on front, definition on back
Comfortable handle
Every order personally reviewed

Customer Reviews

636
62
10
1
15

Thank you for sharing this Unique piece of Artwork. You are the only one that offered this. Thank you for the quality service you have provided not only in what you offer but right on to the quality packaging as well. Thanks again - Peggy Hall

Peggy H. May 22
✓ Verified Purchase

My brother Tom became an uncle & urban dictionary created a wonderful uncle Tom mug…

David J. May 22
✓ Verified Purchase

It is special to have a mug that has to do with my dad who invented a word when we were growing up. He passed away last year. Drinking from this mug is like spending time with him.

Marlene M. May 22
✓ Verified Purchase
Review by Daniel B.

Quick turnaround time and good quality merchandise.

Daniel B. May 19
✓ Verified Purchase

very cool kanye for me gave it to my crush and now were dating so yea

tommy May 19

I bought a Prone mug and i love it its so good imma prone to the bathroom now brb

potato p. May 17

This mug gives my life purpose. It's what I've always said. Patience is a virtue and hard work never betrays. Ever since I was born I've been struck with one misfortune after another, but today it all paid off. I got my own mug, and I use it anywhere and whenever I can! Both of my legs are shattered because to my wife threw me in the middle of traffic and my windpipe is messed up due to me screaming all the way from the crash site to the hospital thanks to the unbearable pain I was feeling. Although even with all that's happened this is still the best day of my life. I suppose the only problem I have is that whenever I happen to look at my cup I get a little too happy. That causes problems because my life support can't handle my exhilaration, haha! I'm just kidding; that was just a little lighthearted joke of mine. I actually cannot afford life support because I spent all of my life savings on this fine piece of pottery. Not to worry though! I can get through the pain with my will and drugs - I mean medication. P.S. There are definitely no ghosts in the mugs. Just wanted to point that out in case someone was worried about that.

Joel K. May 17

I bought two mugs as gifts for coworkers and they were very pleased. The print was clear and concise. Hopefully they last a long time.

Peter A. May 17
✓ Verified Purchase

Ordered a gift for a friend I hope he likes it :)

John G. May 16
✓ Verified Purchase

Mug was well-packed when received. Shipping was timely. The mug was as advertised. Very nice.

Pat P. May 16
✓ Verified Purchase

BEST THING EVER. CUZ YK WHAT!!?!? IT. IS. A. MUG. WITH MY NAME. AND. A COOL DESCRIPTION. ON. IT. I LOVE IT.

GETRC45CG4T X. May 16

Just what I expected! Thank you!

H P. May 16
✓ Verified Purchase

I bought this friggin thing thinking my whole life would change. Guess what? It still sucks! If this friggin thing can't change my life then I don't want it!

Lesko B. May 15

This is a great gift to give after our Urban Dictionary inclusion

Manley P. May 14
✓ Verified Purchase
Review by Chanda J.

It's perfect!! Thank you!

Chanda J. May 13
✓ Verified Purchase

My Name is Walter Hardwell White, My Mug was sent to 308 Negra Aroyal Lane, AQ, New Mexico and arrived on-time and I am very satisfied. My "Glock Dookie" mug is great for my lab work, and my friend Pinkman loves it!

Walter W. May 12

I love this cup! My now ex-husband loves his opioids more than life itself. He would constantly pass out dead to the world the only thing I would here was his death moans. I had to call an aid car for him so many time that I can't remember plus 2 or 3 times the doctors told me that if it wasn't for me, he would have died. Her abandoned me after I was diagnosed with ovarian cancer because I was of no use to him any longer. I have no clue now who must be the one that's obligated to save his life any longer. All I know is I'm free from him now. The only thing I'm waiting for is that he finally overdoses himself & he's dead. I am buying a cup to send to him for our divorce anniversary gift so he can keep it in memory of how he treated me.

Debra I. May 11

I loved it! Excellent quality!

Barbara W. May 10
✓ Verified Purchase

I received the mug as a gift from a friend with whom I exchange "Weekaversary" eMails. I love the concept but am wondering why "aniversary" is spelled with only one "n?"

Suzanne Z. May 9

Wish it had the example text as well, but I loved it anyway

Tory May 9
Page 1 of 37

Also available as

🤖

Shopping Assistant

Online
Hey! 👋 I'm your shopping assistant. What are you looking for?

AI-generated responses. Verify claims.