qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm Mug
This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc. Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.
The Urban Dictionary Mug
Customer Reviews
This is the coolest Anspaugh mug that ever existed.
Great ordering experience..good quality
8.3 cm diameter? I hardly know her
The day this mug entered my life, my depression was cured, I won the lottery, my dad came back from the dead, and my mum started loving me, motto beg but if you rub the mug 3 times a genie WIll grant you 69 wishes (I wished for more mugs 69 times)
Gift for my niece. She loves it.
I don’t really want to by it but I do like that you can customize it Also I do find find funny nearly all the one star reviews are people say “I want the mug for free”
i tried to break this shit mug but died got reincarnated came back to life and this shitty mug was still there
How many ounces does it hold? I don’t know ask him. HIM!HIM! Fuck him! It’s catchy
Great experience with the Urban Dictionary and ordering my mug. Any concerns that were related to them were received promptly. Overall, it was a great experience
i love this mug its not a mistake ITS A MASTERPIECE
Describes my classmate in school, perfect
I love the cup and I’m certain I’ll be checking with you guys in the future..
*To those looking to purchase, others may criticize your sense of humor.* I love the thug shaker mug! It stands out as a quality desk ornament that all of my co workers are envious of. However, the other world leaders seem to find the thug shaker unfunny and immature for the work place. My wife says she will leave me if she sees it out one more time. I think I may have to give up the thug shaker persona once and for all. Stay strong thugs.
fuck you and your mugs give me a shirt or ill shit on you
Love love love it! Customer service gave me a coupon, let me know that I had to revise the definition when too long, and overall super helpful.
Nice Mug my second Mug. A little staining or photo graphic stain on the side of the cup and shown in the picture. As a result I cannot give a 5 Star Review.
The snarky message on the mug always gets big laughs from guests so I'm now using it as my go-to bourbon glass
Love the coffee mug. Would have been nice to see who had the word accepted into Urban Dictionary printed on the bottom of the mug. As I was the one. "Dusty Dawg" Other than that I love.
fuck ur mugs i want one for free
This mug, much like a cursed relic unearthed from the depths of despair, embodies a cacophony of design flaws and manufacturing mishaps that make one wonder if it was birthed from the darkest corners of incompetence itself. From its deceptively promising exterior, which boasts a color scheme akin to a bruised banana left out in the sun for too long, to its handle that feels more like a medieval torture device designed to punish the unsuspecting hand that dares to grasp it, every aspect of this mug screams "regret." Its material, a sinister amalgamation of recycled nightmares and shattered dreams, leeches a flavor reminiscent of stale coffee mixed with the tears of disappointed souls into whatever liquid unfortunate enough to be poured within its cursed confines. The rim, jagged and uneven like the edge of a poorly forged blade, guarantees that each sip is a perilous journey fraught with the risk of lip lacerations and existential dread. And let us not forget the bottom of this vessel, where the manufacturer's logo is stamped with all the subtlety of a scarlet letter, branding the user as a victim of their own poor purchasing decisions for all eternity. Indeed, this mug serves as a stark reminder that sometimes, in the vast expanse of consumer goods, there exists a dark abyss where quality and utility fear to tread, leaving only disappointment and regret in their wake.