qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm
This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc. Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.
The Urban Dictionary Mug
good mug but why does it sometimes say creepy things to me kinda sus ngl
up ya bum
Fast shipment Better than expected!
Customer service was very responsive and helpful
Wowzers

Every web purchase should be this easy! Love it!

Great quality, although a high price for a mug! Printed really nicely and came out really well. $30 worth the laugh.
High quality finish
I just love mugs
balls
HA HA I USED FUNNI NUMBER FUNNI NUMBER GO BRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
gave it to my mom, she was proud. (shes dead)
My maiden name was Puddy and I just loved this mug that defined what Puddy means! I bought one for my brother as well as one for me… And this is the first time in all of our 70 + years that we have heard Puddy defined! We both are super grateful!
The color of the block highlighting the subject word was labeled "Flamingo Pink", but on the mug, it's actually closer to lilac and the woman I bought this mug for loves the color pink. I do like the apparent permanence of the design on the mug, I'm just disappointed with the inaccuracy of the color.
One day when I was walking down the street a man gave me this mug and said that it will be the best thing that ever happened to me, when I got home I filled the mug with the most delicious coffee and I became a penis. this is the best mug in the world thank you kind stranger for giving me this.
quimsy is my son's name. i find this mug overwhelming. there not man things in my possession that i find as overwhelming as this mug
Ah SlaTT Th1S mUg g0T M3 oN THa7 T1M3... S1PP1N L3AN OuT D1S sH1t 🧛♂️💉 *JuS7 A J0k3 vAmP 🤟🏿
This helped me figure out what the word meant when my 35 year old father said he would beat my doonies down. For context I am 12.
Great, it was a gift and he loved it
These mugs are great! Great Quality and variety of colors also!
Review Details
Pro Customization
Create unique products with your own words and definitions
Live Preview
Personalize Your Design
Debug: Product Metadata
Key | Value (click to copy) |
---|---|
Copied!
|
copiedKey = null, 1500);
">
|
Return Policy
Made Just For You
Each product is custom-printed with your unique text, making it truly one-of-a-kind.
Defect-Free Guarantee
If your product arrives with printing defects, damage, or quality issues, we'll send you a free replacement.
Custom Orders
Due to the personalized nature of your order, we don't accept returns for change of mind or sizing issues.
Questions about your order? Contact our support team for assistance.