Menu

Share this page

qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm front
Customize

qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm

This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc. Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.

Checking text fit...
Text fits
Text may be too long -
Text may be too small -
Checking delivery...
Order in for delivery

The Urban Dictionary Mug

Ceramic mug (11 oz)
Printed on-demand just for you
Dishwasher safe
Microwave safe
Word on front, definition on back
Comfortable handle
Every order personally reviewed
636
62
10
1
15

good mug but why does it sometimes say creepy things to me kinda sus ngl

candice d. Oct 20

up ya bum

layla z. Oct 20

Fast shipment Better than expected!

Terry K. Oct 20
✓ Verified Purchase

Customer service was very responsive and helpful

John K. Oct 20
✓ Verified Purchase

Wowzers

Wee Z. Oct 19
Review by Rich T.

Every web purchase should be this easy! Love it!

Rich T. Oct 19
Review by Rebecca V.

Great quality, although a high price for a mug! Printed really nicely and came out really well. $30 worth the laugh.

Rebecca V. Oct 19
✓ Verified Purchase

High quality finish

Ngalasa i. Oct 18

I just love mugs

Ngalasa i. Oct 18

balls

ur m. Oct 18

HA HA I USED FUNNI NUMBER FUNNI NUMBER GO BRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR

Funni Oct 18

gave it to my mom, she was proud. (shes dead)

manfromFL Oct 18

My maiden name was Puddy and I just loved this mug that defined what Puddy means! I bought one for my brother as well as one for me… And this is the first time in all of our 70 + years that we have heard Puddy defined! We both are super grateful!

Theresa A. Oct 18
✓ Verified Purchase

The color of the block highlighting the subject word was labeled "Flamingo Pink", but on the mug, it's actually closer to lilac and the woman I bought this mug for loves the color pink. I do like the apparent permanence of the design on the mug, I'm just disappointed with the inaccuracy of the color.

Dion H. Oct 17
✓ Verified Purchase

One day when I was walking down the street a man gave me this mug and said that it will be the best thing that ever happened to me, when I got home I filled the mug with the most delicious coffee and I became a penis. this is the best mug in the world thank you kind stranger for giving me this.

gay m. Oct 16

quimsy is my son's name. i find this mug overwhelming. there not man things in my possession that i find as overwhelming as this mug

Quimsey S. Oct 16

Ah SlaTT Th1S mUg g0T M3 oN THa7 T1M3... S1PP1N L3AN OuT D1S sH1t 🧛‍♂️💉 *JuS7 A J0k3 vAmP 🤟🏿

Playboi C. Oct 16

This helped me figure out what the word meant when my 35 year old father said he would beat my doonies down. For context I am 12.

Amish P. Oct 16

Great, it was a gift and he loved it

John . Oct 16
✓ Verified Purchase

These mugs are great! Great Quality and variety of colors also!

Jane F. Oct 16
✓ Verified Purchase

Review Details

Pro Customization

Create unique products with your own words and definitions

Live Preview

Front Preview
Back Preview

Personalize Your Design

Checking text fit...
Text fits
Text may be too long
Text may be too small

Debug: Product Metadata

Key Value (click to copy)

Return Policy

Made Just For You

Each product is custom-printed with your unique text, making it truly one-of-a-kind.

Defect-Free Guarantee

If your product arrives with printing defects, damage, or quality issues, we'll send you a free replacement.

Custom Orders

Due to the personalized nature of your order, we don't accept returns for change of mind or sizing issues.

Questions about your order? Contact our support team for assistance.

Tap here to close
Swipe to navigate • Pinch to zoom

Share this product

Size Guide

Your Security Matters

Powered by Stripe

Your payment information is encrypted and processed securely by Stripe, trusted by millions of businesses worldwide.

PCI DSS Compliant

Our payment providers meet the highest standards of payment security set by the Payment Card Industry.

Your Data is Protected

Urban Dictionary never stores your credit card details. All transactions are encrypted using industry-standard SSL technology.

Quality Production

Products are made-to-order with quality materials at global facilities to reduce shipping time and environmental impact.

Your trust is our priority. If you have any security concerns, please contact our support team.

Free Shipping Worldwide

Loading shipping information...

No hidden fees, no surprises at checkout

Order Placed

Your custom product joins today's batch if you order in Your custom product joins today's batch

Made On-Demand

Printed at the closest facility to reduce shipping time from facilities in North America, Europe, Asia & Australia

Free Shipping

Your package ships to your door at no extra cost

Delivered

Estimated delivery Arrives in 5-10 business days

Times vary by location. Products are custom-made to reduce waste.

🤖

Shopping Assistant

AI-generated responses. Verify facts.
Conversations may be monitored.