Menu

Share this page

qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm front
Customize

qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm

This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc. Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.

Checking text fit...
Text fits
Text may be too long -
Text may be too small -
Checking delivery...
Order in for delivery

The Urban Dictionary Hoodie

Soft and cozy blend
Printed on-demand just for you
Drawstring hood
Front pouch pocket
Ribbed cuffs and waistband
Design on front, blank back
Every order personally reviewed
23
5
0
0
0

Absolutely brilliant my Argentinian son wi be very pleased

Big S. Oct 20

My boy like the hooded attire.

Ngalasa i. Oct 18

Navy Quality Goods Awesome! My girlfriend Becca loves it!

Alex Sadler Sep 24

Navy Quality Goods I bought this shirt to wear whilst i sail the seven seas with my sea cadet friends, i really like the design because i can walk around and everyone knows im a wannabe pirate. I also like the colour choice, i am able to use it as my stealth suit whilst we do our practice drills with spray painted nerf guns :) would buy again!

Alex Sadler Sep 24

Nice It's pretty good to describe my mood around my parents!! Love this! Make more!

Lol Sep 14

Shit

Kakkakajs Aug 27

i said shart and wore it to a party

i dont e. Jul 4

wrote shart and wore it to a party

tyler j. Jul 4

SUPER SIGMA. I LOVE IT.

Kai C. Jul 1

why I can't believe that I found it. A diamond in the dust. a needle in the haystack. A Chankla hoodie. no seriously I just bought a hoodie that only said Chankla. Best purchase btw

Why May 21

Pretty good It isn’t very hot and sweaty but other than that it is pretty good

Gillian Apr 23

TO THOSE ASKING, YES, THE GORGEOUS MAN COMES WITH THE SWEATSHIRT BUTTTT YOU HAVE TO PAY 100 TIMES MORE THAN ASKING!

smiggen s. Mar 10

Better then Gucci and LV I bought 3 of these and omg I’m done it’s literally the best hoodie I have ever worn.Its so good that I think the hoodie give me powers like Shaggy.I hope this becomes better than any other brand that’s how good it is.

Harold Mar 5

Orderd a large hoodie about two years ago and the print in still holding up. I recently order a XL just do to the fact that the original has shrunk a little. The new hoodie is made with thicker material and fits perfect. I recommend ordering one size up.

Marcus D M. Mar 4
✓ Verified Purchase

Hahaha hoodie says cum dump and I wore it in public

Katrina S. Mar 3

Question… does that gorgeous man come with the sweatshirt? I will gladly pay 100 times more than asking!

Maddi M. Feb 27

bro my dog started barking when I wore this hoodie, he started talking in spanish and was like "Aiiiiii te ves sexy ¿Puedo conseguir tu número?" and then he did the stanky leg before he packed his bags and got 3 tickets to bikini bottom. I asked him who the other 2 people were and he told me "nah i just tryna sleep". Had to respect the dog, he got that dog in him. but yeah the hoodie was warm

Dogsta G. Feb 26

made me look like the gyatt rizzler,the girls loved it!!!

kai h. Feb 16

It was softer than expected! Great fit for me, I love the way it wears. It is my favorite sweatshirt

Craig C. Feb 11
✓ Verified Purchase

Size adult medium unisex was a perfect fit. Shirt was very soft. Could be a bit thicker for the price.

Art N. Feb 2
✓ Verified Purchase

Review Details

Pro Customization

Create unique products with your own words and definitions

Live Preview

Front Preview
Back Preview

Personalize Your Design

Checking text fit...
Text fits
Text may be too long
Text may be too small

Debug: Product Metadata

Key Value (click to copy)

Return Policy

Made Just For You

Each product is custom-printed with your unique text, making it truly one-of-a-kind.

Defect-Free Guarantee

If your product arrives with printing defects, damage, or quality issues, we'll send you a free replacement.

Custom Orders

Due to the personalized nature of your order, we don't accept returns for change of mind or sizing issues.

Questions about your order? Contact our support team for assistance.

Tap here to close
Swipe to navigate • Pinch to zoom

Share this product

Size Guide

Measurements may vary by up to 2" (5 cm). Pro tip: Measure one of your hoodies at home and compare!

Hoodie measurements

A - Length

Measure from the top of the collar to the bottom hem

B - Width

Measure across the chest from side to side

C - Sleeve Length

Measure from center back collar, over shoulder, down to cuff

Size Chart

Size Length Width Sleeve
S27"20"33½"
M28"22"34½"
L29"24"35½"
XL30"26"36½"
2XL31"28"37½"
3XL32"30"38½"
Size Length Width Sleeve
S69 cm51 cm85 cm
M71 cm56 cm88 cm
L74 cm61 cm90 cm
XL76 cm66 cm93 cm
2XL79 cm71 cm95 cm
3XL81 cm76 cm98 cm

Your Security Matters

Powered by Stripe

Your payment information is encrypted and processed securely by Stripe, trusted by millions of businesses worldwide.

PCI DSS Compliant

Our payment providers meet the highest standards of payment security set by the Payment Card Industry.

Your Data is Protected

Urban Dictionary never stores your credit card details. All transactions are encrypted using industry-standard SSL technology.

Quality Production

Products are made-to-order with quality materials at global facilities to reduce shipping time and environmental impact.

Your trust is our priority. If you have any security concerns, please contact our support team.

Free Shipping Worldwide

Loading shipping information...

No hidden fees, no surprises at checkout

Order Placed

Your custom product joins today's batch if you order in Your custom product joins today's batch

Made On-Demand

Printed at the closest facility to reduce shipping time from facilities in North America, Europe, Asia & Australia

Free Shipping

Your package ships to your door at no extra cost

Delivered

Estimated delivery Arrives in 5-10 business days

Times vary by location. Products are custom-made to reduce waste.

🤖

Shopping Assistant

AI-generated responses. Verify facts.
Conversations may be monitored.