qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm
This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc. Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.
The Urban Dictionary Hoodie
Absolutely brilliant my Argentinian son wi be very pleased
My boy like the hooded attire.
Navy Quality Goods Awesome! My girlfriend Becca loves it!
Navy Quality Goods I bought this shirt to wear whilst i sail the seven seas with my sea cadet friends, i really like the design because i can walk around and everyone knows im a wannabe pirate. I also like the colour choice, i am able to use it as my stealth suit whilst we do our practice drills with spray painted nerf guns :) would buy again!
Nice It's pretty good to describe my mood around my parents!! Love this! Make more!
Shit
i said shart and wore it to a party
wrote shart and wore it to a party
SUPER SIGMA. I LOVE IT.
why I can't believe that I found it. A diamond in the dust. a needle in the haystack. A Chankla hoodie. no seriously I just bought a hoodie that only said Chankla. Best purchase btw
Pretty good It isn’t very hot and sweaty but other than that it is pretty good
TO THOSE ASKING, YES, THE GORGEOUS MAN COMES WITH THE SWEATSHIRT BUTTTT YOU HAVE TO PAY 100 TIMES MORE THAN ASKING!
Better then Gucci and LV I bought 3 of these and omg I’m done it’s literally the best hoodie I have ever worn.Its so good that I think the hoodie give me powers like Shaggy.I hope this becomes better than any other brand that’s how good it is.
Orderd a large hoodie about two years ago and the print in still holding up. I recently order a XL just do to the fact that the original has shrunk a little. The new hoodie is made with thicker material and fits perfect. I recommend ordering one size up.
Hahaha hoodie says cum dump and I wore it in public
Question… does that gorgeous man come with the sweatshirt? I will gladly pay 100 times more than asking!
bro my dog started barking when I wore this hoodie, he started talking in spanish and was like "Aiiiiii te ves sexy ¿Puedo conseguir tu número?" and then he did the stanky leg before he packed his bags and got 3 tickets to bikini bottom. I asked him who the other 2 people were and he told me "nah i just tryna sleep". Had to respect the dog, he got that dog in him. but yeah the hoodie was warm
made me look like the gyatt rizzler,the girls loved it!!!
It was softer than expected! Great fit for me, I love the way it wears. It is my favorite sweatshirt
Size adult medium unisex was a perfect fit. Shirt was very soft. Could be a bit thicker for the price.
Review Details
Pro Customization
Create unique products with your own words and definitions
Live Preview
Personalize Your Design
Debug: Product Metadata
Key | Value (click to copy) |
---|---|
Copied!
|
copiedKey = null, 1500);
">
|
Return Policy
Made Just For You
Each product is custom-printed with your unique text, making it truly one-of-a-kind.
Defect-Free Guarantee
If your product arrives with printing defects, damage, or quality issues, we'll send you a free replacement.
Custom Orders
Due to the personalized nature of your order, we don't accept returns for change of mind or sizing issues.
Questions about your order? Contact our support team for assistance.
Share this product
Size Guide
Measurements may vary by up to 2" (5 cm). Pro tip: Measure one of your hoodies at home and compare!
A - Length
Measure from the top of the collar to the bottom hem
B - Width
Measure across the chest from side to side
C - Sleeve Length
Measure from center back collar, over shoulder, down to cuff
Size Chart
Size | Length | Width | Sleeve |
---|---|---|---|
S | 27" | 20" | 33½" |
M | 28" | 22" | 34½" |
L | 29" | 24" | 35½" |
XL | 30" | 26" | 36½" |
2XL | 31" | 28" | 37½" |
3XL | 32" | 30" | 38½" |
Size | Length | Width | Sleeve |
---|---|---|---|
S | 69 cm | 51 cm | 85 cm |
M | 71 cm | 56 cm | 88 cm |
L | 74 cm | 61 cm | 90 cm |
XL | 76 cm | 66 cm | 93 cm |
2XL | 79 cm | 71 cm | 95 cm |
3XL | 81 cm | 76 cm | 98 cm |