qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm custom mug

This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc. Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.

Tee Hoodie

The Urban Dictionary Mug

You might also like

Customer Reviews

636
62
10
1
15

Cute, simple, as advertised.

Eli S. Sep 28
✓ Verified Purchase

My great great great great great uncle’s dog’s daughter’s owner’s sister loved this mug. Must recomend!!!

Dhar M. Sep 26

Got this for my dog

Kolbie L. Sep 25
Customer photo from Joy B.'s review

As a Jolology major, I love my new mug!

Joy B. Sep 25
✓ Verified Purchase

It was for a friends 70th b-day. When we order it, it was going to come 2 day after the party. But we were so excited it came 3 days before his party. It was a big hit. Thank you.

Cindy C. Sep 24
✓ Verified Purchase

I gave it as a gift and the recipient loved it. No indication where it was made, so maybe USA? That would be really nice, if so.

William K. Sep 24
✓ Verified Purchase

I appreciated the email asking if the content was correct. Excellent quality and attention to detail. Thank you!

James H. Sep 23
✓ Verified Purchase

its an incredible mug! i would recommend purchasing this awesome product!

bill n. Sep 23

Damonism and #Stolen Valor Coffee Mug These coffee mugs are rugged, solid, high quality and keep the liquids hotter, longer. The definitions of both mugs are spot-on! I will definitely by more. Great work Urban Dictionary!

Forced Karma Sauce Sep 23

why is this a real thing? AND YA'LL ACTING LIKE IT'S NORMAL!?

Ako g. Sep 22

I really like the mug, but I thought I had ordered the all pink one. What came was a white with a block of pink with "Fubar" written on it.

Barbara S. Sep 22
✓ Verified Purchase

the only reason why i care about humanity this mug is the reason why i believe humanity deserves a second chance, even after they blaspheme my name. this mug is the greatest thing i've ever seen and i have ordered many of them. this mug replaces the holy grail. the bible should've told about the wonderful deeds of the mug and how it saved humanity from my wrath. alas, whilst the laws keep me from tampering with human minds and altering holy objects like the bible, i can only pass on my message: "spread the news and buy this mug!"

GOD Sep 21

Its.. omg, its............. AMAZING AMAZING OMG ITS SOOO GOOD

desfhueshd e. Sep 21

A mug for your boyfriend Paul????? My boyfriend is not called Paul. I don't even have a boyfriend

Yolanda Linares Sep 19

Great mug... finally got my ""your mom gay lol" mug, I'm so happy

Jackoof Sep 18

ariana grande mug omg this slays mah life

ariana grande is a queen Sep 18

It was easy to correct grammar when necessary, and then to order a great gift for a member of a wedding party. Nice, simple, and sturdy mug.

Etan N. Sep 18
✓ Verified Purchase

with this we regain gods trust This mug changes my views of humanity. I think we may have a chance of not going extinct. Everyone should own this fantastic mug. Oh it's also has a nice handle.

Yeet Skeet Sep 17

Love that I got an Urban Dictionary word definition from someone I know! So much fun and great memory item!! 😊

Jamie W. Sep 15
✓ Verified Purchase

I like it but it took a long time getting here

Bruce M. Sep 15
✓ Verified Purchase
Page 1 of 37
Feedback