qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm
This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc. Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.
The Urban Dictionary Tee
I love it I bought me and my family some
Glad I had utmost FREEDOM OF SPEECH to express in articulate detail what evv it is the fk i was on a rant about that day. I haven't even received my shirt. I just a few moments ago placed the order. That is how pleased 😄 I am. Fk yeah fk yeah. Very empowering experience. My thoughts turned into type, that made some shi# happen. Having freedom of expression was most definitely...one fk ton of fun. A fk ton can be quantified as exuberance an joy beyond expectation. Fk yeah fk yeah. Awesome>>>
Proofread much? She might seem "quite"? Please fix the spelling to "quiet". Can't believe I was considering this purchase...
Damonism T-shirt :+) I found this by accident while surfing through your site. I love this shirt. I bought one and wear it when I feel frisky.
Another hit!
Great shirt, great service. A big thumbs up👍🏻
I always get so many compliments when I wear this (my favorite) shirt. I have been able to give out my phone number to lots of nice old men and my parents think it's great that I have so many nice mentors grooming me into a nice young boy who is willing to "follow the rules ".
Very comfortable and love the tyoeface
Very nice t-shirt. Fits perfect.
FUCK you urban dictionary.

My brother loved the shirt and the dogs name is cum stain
The small shirts for men looks like an extra small. Other than that I love the shirt.
AMAZING I GOT THE HILAARIOUS SHIRT AND LOVE IT MORE THAN ANYTHING!

I absolutely loveeeeeeee my shirt ! Fast shipping too !
hehe mine said skibidi

Feels great love the shitt
Great shirt. Great service. Shopify doesn’t track the shipment accurately though. However, when I reached out to Urban Dictionary customer service, they were able to help me.
Wore it to school.
Love this shirt so much

I love this t-shirt that says morbussy. It allows me to show off both my love for Morbius and the fact that I get no Morbussy.
Review Details
Pro Customization
Create unique products with your own words and definitions
Live Preview
Personalize Your Design
Debug: Product Metadata
Key | Value (click to copy) |
---|---|
Copied!
|
copiedKey = null, 1500);
">
|
Return Policy
Made Just For You
Each product is custom-printed with your unique text, making it truly one-of-a-kind.
Defect-Free Guarantee
If your product arrives with printing defects, damage, or quality issues, we'll send you a free replacement.
Custom Orders
Due to the personalized nature of your order, we don't accept returns for change of mind or sizing issues.
Questions about your order? Contact our support team for assistance.
Share this product
Size Guide
Measurements may vary by up to 2" (5 cm). Pro tip: Measure one of your t-shirts at home and compare!
A - Length
Measure from the top of the collar to the bottom hem
B - Width
Measure across the chest from armpit to armpit
Size Chart
Size | Length | Width |
---|---|---|
XS | 27" | 16½" |
S | 28" | 18" |
M | 29" | 20" |
L | 30" | 22" |
XL | 31" | 24" |
2XL | 32" | 26" |
3XL | 33" | 28" |
Size | Length | Width |
---|---|---|
XS | 69 cm | 42 cm |
S | 71 cm | 46 cm |
M | 74 cm | 51 cm |
L | 76 cm | 56 cm |
XL | 79 cm | 61 cm |
2XL | 81 cm | 66 cm |
3XL | 84 cm | 71 cm |