Menu

Share this page

qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm front
Customize

qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm

This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc. Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.

Checking text fit...
Text fits
Text may be too long -
Text may be too small -
Checking delivery...
Order in for delivery

The Urban Dictionary Tee

Soft, comfortable fabric
Printed on-demand just for you
True to size fit
Pre-shrunk (won't shrink in wash)
Tear-away label (no itchy tags)
Every order personally reviewed
71
8
1
0
3

I love it I bought me and my family some

Kirk J. Oct 20

Glad I had utmost FREEDOM OF SPEECH to express in articulate detail what evv it is the fk i was on a rant about that day. I haven't even received my shirt. I just a few moments ago placed the order. That is how pleased 😄 I am. Fk yeah fk yeah. Very empowering experience. My thoughts turned into type, that made some shi# happen. Having freedom of expression was most definitely...one fk ton of fun. A fk ton can be quantified as exuberance an joy beyond expectation. Fk yeah fk yeah. Awesome>>>

Jamie M. Oct 16

Proofread much? She might seem "quite"? Please fix the spelling to "quiet". Can't believe I was considering this purchase...

cynthia Oct 13

Damonism T-shirt :+) I found this by accident while surfing through your site. I love this shirt. I bought one and wear it when I feel frisky.

Dee Oct 13

Another hit!

John E. Sep 25
✓ Verified Purchase

Great shirt, great service. A big thumbs up👍🏻

Beren S. Sep 24
✓ Verified Purchase

I always get so many compliments when I wear this (my favorite) shirt. I have been able to give out my phone number to lots of nice old men and my parents think it's great that I have so many nice mentors grooming me into a nice young boy who is willing to "follow the rules ".

Rick S. Sep 11

Very comfortable and love the tyoeface

John E. Sep 5
✓ Verified Purchase

Very nice t-shirt. Fits perfect.

Angela J. Sep 2
✓ Verified Purchase

FUCK you urban dictionary.

Nah N. Aug 21
Review by Malachy G.

My brother loved the shirt and the dogs name is cum stain

Malachy G. Aug 6
✓ Verified Purchase

The small shirts for men looks like an extra small. Other than that I love the shirt.

Dian C. Aug 5
✓ Verified Purchase

AMAZING I GOT THE HILAARIOUS SHIRT AND LOVE IT MORE THAN ANYTHING!

scarlett Jul 31
Review by Kristen G.

I absolutely loveeeeeeee my shirt ! Fast shipping too !

Kristen G. Jul 22
✓ Verified Purchase

hehe mine said skibidi

alpha g. Jul 22
Review by Fred F.

Feels great love the shitt

Fred F. Jul 3
✓ Verified Purchase

Great shirt. Great service. Shopify doesn’t track the shipment accurately though. However, when I reached out to Urban Dictionary customer service, they were able to help me.

Smitha M. Jul 3
✓ Verified Purchase

Wore it to school.

Monica L. Jun 28

Love this shirt so much

Joey L. Jun 16
✓ Verified Purchase
Review by No M.

I love this t-shirt that says morbussy. It allows me to show off both my love for Morbius and the fact that I get no Morbussy.

No M. Jun 15

Review Details

Pro Customization

Create unique products with your own words and definitions

Live Preview

Front Preview
Back Preview

Personalize Your Design

Checking text fit...
Text fits
Text may be too long
Text may be too small

Debug: Product Metadata

Key Value (click to copy)

Return Policy

Made Just For You

Each product is custom-printed with your unique text, making it truly one-of-a-kind.

Defect-Free Guarantee

If your product arrives with printing defects, damage, or quality issues, we'll send you a free replacement.

Custom Orders

Due to the personalized nature of your order, we don't accept returns for change of mind or sizing issues.

Questions about your order? Contact our support team for assistance.

Tap here to close
Swipe to navigate • Pinch to zoom

Share this product

Size Guide

Measurements may vary by up to 2" (5 cm). Pro tip: Measure one of your t-shirts at home and compare!

T-shirt measurements

A - Length

Measure from the top of the collar to the bottom hem

B - Width

Measure across the chest from armpit to armpit

Size Chart

Size Length Width
XS27"16½"
S28"18"
M29"20"
L30"22"
XL31"24"
2XL32"26"
3XL33"28"
Size Length Width
XS69 cm42 cm
S71 cm46 cm
M74 cm51 cm
L76 cm56 cm
XL79 cm61 cm
2XL81 cm66 cm
3XL84 cm71 cm

Your Security Matters

Powered by Stripe

Your payment information is encrypted and processed securely by Stripe, trusted by millions of businesses worldwide.

PCI DSS Compliant

Our payment providers meet the highest standards of payment security set by the Payment Card Industry.

Your Data is Protected

Urban Dictionary never stores your credit card details. All transactions are encrypted using industry-standard SSL technology.

Quality Production

Products are made-to-order with quality materials at global facilities to reduce shipping time and environmental impact.

Your trust is our priority. If you have any security concerns, please contact our support team.

Free Shipping Worldwide

Loading shipping information...

No hidden fees, no surprises at checkout

Order Placed

Your custom product joins today's batch if you order in Your custom product joins today's batch

Made On-Demand

Printed at the closest facility to reduce shipping time from facilities in North America, Europe, Asia & Australia

Free Shipping

Your package ships to your door at no extra cost

Delivered

Estimated delivery Arrives in 5-10 business days

Times vary by location. Products are custom-made to reduce waste.

🤖

Shopping Assistant

AI-generated responses. Verify facts.
Conversations may be monitored.