qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm

This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc. Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.